translocase of outer mitochondrial membrane 20 homolog (yeast), Mouse, Clone: 4F3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant TOMM20.

Supplier:  Abnova Corporation H00009804M01

Catalog No. 89-014-244

Description

Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Specifications

• Antigen: translocase of outer mitochondrial membrane 20 homolog (yeast)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC066335
• Gene Symbols: TOMM20
• Immunogen: TOMM20 (AAH66335, 1 a.a. ∼ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 4F3
• Description: Mouse monoclonal antibody raised against a full length recombinant TOMM20.
• Gene: TOMM20
• Gene Alias: KIAA0016/MAS20/MGC117367/MOM19/TOM20
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9804
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ