Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004451

translocase of outer mitochondrial membrane 20 homolog (yeast), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004451 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-451 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-451 Supplier Abnova Corporation Supplier No. H00009804A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length recombinant TOMM20.

Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Specifications

Antigen translocase of outer mitochondrial membrane 20 homolog (yeast)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length recombinant TOMM20.
Formulation 50% glycerol
Gene TOMM20
Gene Accession No. BC066335
Gene Alias KIAA0016/MAS20/MGC117367/MOM19/TOM20
Gene Symbols TOMM20
Host Species Mouse
Immunogen TOMM20 (AAH66335, 1 a.a. ∼ 145 a.a) full-length recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 9804
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.