Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

translocase of outer mitochondrial membrane 22 homolog (yeast), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant TOMM22.

Manufacturer:  Abnova Corporation H00056993A01

Catalog No. 89-004-689


Add to cart

Description

Description

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq

Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Specifications

Specifications

translocase of outer mitochondrial membrane 22 homolog (yeast)
Unconjugated
50% glycerol
BC009363
1C9-2|MST065|MSTP065|TOM22
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human, Murine, Rat
ELISA, Western Blot
Mouse polyclonal antibody raised against a full-length recombinant TOMM22.
TOMM22
Serum
TOMM22
TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
56993
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit