translocase of outer mitochondrial membrane 22 homolog (yeast), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant TOMM22.

Supplier:  Abnova Corporation H00056993A01

Catalog No. 89-004-689

Description

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq

Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Specifications

• Antigen: translocase of outer mitochondrial membrane 22 homolog (yeast)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant TOMM22.
• Gene: TOMM22
• Gene Alias: 1C9-2/MST065/MSTP065/TOM22
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC009363
• Gene Symbols: TOMM22
• Immunogen: TOMM22 (AAH09363, 1 a.a. ∼ 142 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 56993
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.