translocase of outer mitochondrial membrane 34, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-254	100 μg

Catalog No. 89-018-254 Supplier Abnova Corporation Supplier No. H00010953D01P

Description

Rabbit polyclonal antibody raised against a full-length human TOMM34 protein.

The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. [provided by RefSeq

Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH

Specifications

• Antigen: translocase of outer mitochondrial membrane 34
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human TOMM34 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TOMM34
• Gene Accession No.: NM_006809.4
• Gene Alias: HTOM34P/TOM34/URCC3
• Gene Symbols: TOMM34
• Host Species: Rabbit
• Immunogen: TOMM34 (NP_006800.2, 1 a.a. ∼ 309 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10953
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG