tumor protein p53 binding protein, 2, Mouse, Clone: 3F8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TP53BP2.

Supplier:  Abnova Corporation H00007159M01

Catalog No. 89-014-204

Description

This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS

Specifications

• Antigen: tumor protein p53 binding protein, 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC058918
• Gene Symbols: TP53BP2
• Immunogen: TP53BP2 (AAH58918, 511 a.a. ∼ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 7159
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 3F8
• Description: Mouse monoclonal antibody raised against a partial recombinant TP53BP2.
• Gene: TP53BP2
• Gene Alias: 53BP2/ASPP2/BBP/PPP1R13A/p53BP2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody