TPP1, Mouse, Clone: 3B1, Abnova™

Catalog No.	Quantity
89-021-117	100 μg

Catalog No. 89-021-117 Supplier Abnova Corporation Supplier No. H00001200M01

Description

Mouse monoclonal antibody raised against a partial recombinant TPP1.

This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq

Sequence: GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF

Specifications

• Antigen: TPP1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3B1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TPP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TPP1
• Gene Accession No.: BC014863
• Gene Alias: CLN2/GIG1/LPIC/MGC21297
• Gene Symbols: TPP1
• Host Species: Mouse
• Immunogen: TPP1 (AAH14863, 195 a.a. ∼ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1200
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ