TPP1, Mouse, Clone: 3B1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TPP1.

Supplier:  Abnova Corporation H00001200M01

Catalog No. 89-021-117

Description

This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq

Sequence: GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF

Specifications

• Antigen: TPP1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC014863
• Gene Symbols: TPP1
• Immunogen: TPP1 (AAH14863, 195 a.a. ∼ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 3B1
• Description: Mouse monoclonal antibody raised against a partial recombinant TPP1.
• Gene: TPP1
• Gene Alias: CLN2/GIG1/LPIC/MGC21297
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1200
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid