tribbles homolog 3 (Drosophila), Mouse, Clone: 2G5, Abnova™

Catalog No.	Quantity
89-001-329	100 μg

Catalog No. 89-001-329 Supplier Abnova Corporation Supplier No. H00057761M06

Description

Mouse monoclonal antibody raised against a partial recombinant TRIB3.

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. [provided by RefSeq

Sequence: PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH

Specifications

• Antigen: tribbles homolog 3 (Drosophila)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIB3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TRIB3
• Gene Accession No.: BC027484
• Gene Alias: C20orf97/NIPK/SINK/SKIP3/TRB3
• Gene Symbols: TRIB3
• Host Species: Mouse
• Immunogen: TRIB3 (AAH27484, 56 a.a. ∼ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 57761
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ