tripartite motif-containing 28, Mouse, Clone: 1D11, Abnova™

Catalog No.	Quantity
89-001-166	100 μg

Catalog No. 89-001-166 Supplier Abnova Corporation Supplier No. H00010155M02

Description

Mouse monoclonal antibody raised against a partial recombinant TRIM28.

The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq

Sequence: IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER

Specifications

• Antigen: tripartite motif-containing 28
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1D11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM28.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TRIM28
• Gene Accession No.: BC004978
• Gene Alias: FLJ29029/KAP1/RNF96/TF1B/TIF1B
• Gene Symbols: TRIM28
• Host Species: Mouse
• Immunogen: TRIM28 (AAH04978, 379 a.a. ∼ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10155
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ