tripartite motif-containing 33, Mouse, Clone: 6F4, Abnova™

Catalog No.	Quantity
89-001-284	100 μg

Catalog No. 89-001-284 Supplier Abnova Corporation Supplier No. H00051592M02

Description

Mouse monoclonal antibody raised against a partial recombinant TRIM33.

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. [provided by RefSeq

Sequence: VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS

Specifications

• Antigen: tripartite motif-containing 33
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6F4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM33.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TRIM33
• Gene Accession No.: NM_015906
• Gene Alias: FLJ32925/PTC7/RFG7/TF1G/TIF1G/TIF1GAMMA/TIFGAMMA
• Gene Symbols: TRIM33
• Host Species: Mouse
• Immunogen: TRIM33 (NP_056990, 1006 a.a. ∼ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51592
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ