tripartite motif-containing 33, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TRIM33.

Supplier:  Abnova Corporation H00051592A01

Catalog No. 89-004-634

Description

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. [provided by RefSeq

Sequence: VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS

Specifications

• Antigen: tripartite motif-containing 33
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIM33.
• Gene: TRIM33
• Gene Alias: FLJ32925/PTC7/RFG7/TF1G/TIF1G/TIF1GAMMA/TIFGAMMA
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 51592
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_015906
• Gene Symbols: TRIM33
• Immunogen: TRIM33 (NP_056990, 1006 a.a. ∼ 1105 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum