tripartite motif-containing 37, Mouse, Clone: 2D11, Abnova™

Catalog No.	Quantity
89-014-152	100 μg

Catalog No. 89-014-152 Supplier Abnova Corporation Supplier No. H00004591M01

Description

Mouse monoclonal antibody raised against a partial recombinant TRIM37.

This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR

Specifications

• Antigen: tripartite motif-containing 37
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2D11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM37.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TRIM37
• Gene Accession No.: NM_015294
• Gene Alias: KIAA0898/MUL/POB1/TEF3
• Gene Symbols: TRIM37
• Host Species: Mouse
• Immunogen: TRIM37 (NP_056109, 865 a.a. ∼ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Gene ID (Entrez): 4591
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ