Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001323

tripartite motif-containing 49, Mouse, Clone: 3C7, Abnova™

Catalog No. 89001323 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-323 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-323 Supplier Abnova Corporation Supplier No. H00057093M05
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TRIM49.

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This gene has been found to be preferentially expressed in testis. [provided by RefSeq

Sequence: ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK

Specifications

Antigen tripartite motif-containing 49
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3C7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TRIM49.
Formulation PBS with no preservative; pH 7.4
Gene TRIM49
Gene Accession No. NM_020358
Gene Alias RNF18
Gene Symbols TRIM49
Host Species Mouse
Immunogen TRIM49 (NP_065091, 251 a.a. ∼ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 57093
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.