tripartite motif-containing 56, Mouse, Clone: 4C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TRIM56.

Supplier:  Abnova Corporation H00081844M01

Catalog No. 89-014-338

Description

Sequence: NSVVICDGLGQVVGEYKGPGLHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS

Specifications

• Antigen: tripartite motif-containing 56
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_030961
• Gene Symbols: TRIM56
• Immunogen: TRIM56 (NP_112223, 656 a.a. ∼ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Ubiquitin/Proteasome
• Gene ID (Entrez): 81844
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4C5
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM56.
• Gene: TRIM56
• Gene Alias: DKFZp667O116/FLJ35608/RNF109
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody