tripartite motif-containing 6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TRIM6.

Supplier:  Abnova Corporation H00117854A01

Catalog No. 89-004-772

Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the nucleus, but its specific function has not been identified. This gene is mapped to chromosome 11p15, where it resides within a TRIM gene cluster. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. A read-through transcript transcribed from this gene and TRIM34 has been observed. [provided by RefSeq

Sequence: DVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSG

Specifications

• Antigen: tripartite motif-containing 6
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIM6.
• Gene: TRIM6
• Gene Alias: RNF89
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001003818
• Gene Symbols: TRIM6
• Immunogen: TRIM6 (NP_001003818, 282 a.a. ∼ 381 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 117854
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.