TRIM6-TRIM34 readthrough transcript, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-836	50 μL

Catalog No. 89-004-836 Supplier Abnova Corporation Supplier No. H00445372A01

Description

Mouse polyclonal antibody raised against a partial recombinant TRIM6-TRIM34.

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene represents a read-through transcript transcribed from genes TRIM6 and TRIM34, and it was described as a splice variant of TRIM34. This gene is mapped to chromosome 11p15, where it resides within a TRIM gene cluster. [provided by RefSeq

Sequence: LQMFRELTAVRCYWVDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVYCRTYSRHMKYVVRRCANRQN

Specifications

• Antigen: TRIM6-TRIM34 readthrough transcript
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIM6-TRIM34.
• Formulation: 50% glycerol
• Gene: TRIM6-TRIM34
• Gene Accession No.: NM_001003819
• Gene Alias: IFP1/RNF21/TRIM34
• Gene Symbols: TRIM6-TRIM34
• Host Species: Mouse
• Immunogen: TRIM6-TRIM34 (NP_001003819, 641 a.a. ∼ 740 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 445372
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum