TRIM72 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP155029

Catalog No. NBP155029

Description

TRIM72 Polyclonal specifically detects TRIM72 in Human, Mouse samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: TRIM72
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MG53Mg53, Mitsugumin-53, tripartite motif containing 72, tripartite motif-containing 72, tripartite motif-containing protein 72
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 493829
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q6ZMU5
• Gene Symbols: TRIM72
• Immunogen: Synthetic peptides corresponding to TRIM72(tripartite motif-containing 72) The peptide sequence was selected from the N terminal of TRIM72 (NP_001008275). Peptide sequence CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Mouse reactivity reported in scientific literature (PMID: 25216637).
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only