thyroid hormone receptor interactor 6 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-353	50 μL

Catalog No. 89-004-353 Supplier Abnova Corporation Supplier No. H00007205A02

Description

Mouse polyclonal antibody raised against a partial recombinant TRIP6.

This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq

Sequence: SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP

Specifications

• Antigen: thyroid hormone receptor interactor 6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIP6.
• Formulation: 50% glycerol
• Gene: TRIP6
• Gene Accession No.: NM_003302
• Gene Alias: MGC10556/MGC10558/MGC29959/MGC3837/MGC4423/OIP1/ZRP-1
• Gene Symbols: TRIP6
• Host Species: Mouse
• Immunogen: TRIP6 (NP_003293, 51 a.a. ∼ 148 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7205
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum