transient receptor potential cation channel, subfamily A, member 1, Mouse, Clone: 6G8, Abnova™

Catalog No.	Quantity
89-014-231	100 μg

Catalog No. 89-014-231 Supplier Abnova Corporation Supplier No. H00008989M03

Description

Mouse monoclonal antibody raised against a partial recombinant TRPA1.

The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq

Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL

Specifications

• Antigen: transient receptor potential cation channel, subfamily A, member 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6G8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRPA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TRPA1
• Gene Accession No.: NM_007332
• Gene Alias: ANKTM1
• Gene Symbols: TRPA1
• Host Species: Mouse
• Immunogen: TRPA1 (NP_015628, 1033 a.a. ∼ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8989
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ