Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRPM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159618
Description
TRPM2 Polyclonal specifically detects TRPM2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TRPM2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient receptor potential cation channel, subfamily M, member 2, Transient receptor potential channel 7, TrpC7 | |
| Rabbit | |
| 171 kDa | |
| 100 μL | |
| Apoptosis, Cell Biology, Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neuroscience, Neurotransmission, Signal Transduction | |
| 7226 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| O94759 | |
| TRPM2 | |
| Synthetic peptides corresponding to TRPM2(transient receptor potential cation channel, subfamily M, member 2) The peptide sequence was selected from the N terminal of TRPM2. Peptide sequence VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Porcine 88%, Canine 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction