TRPM7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-154	50 μL

Catalog No. 89-003-154 Supplier Abnova Corporation Supplier No. H00054822A01

Description

Mouse polyclonal antibody raised against a partial recombinant TRPM7.

TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.[supplied by OMIM

Sequence: KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK

Specifications

• Antigen: TRPM7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TRPM7.
• Formulation: 50% glycerol
• Gene: TRPM7
• Gene Accession No.: NM_017672
• Gene Alias: CHAK/CHAK1/FLJ20117/FLJ25718/LTRPC7/TRP-PLIK
• Gene Symbols: TRPM7
• Host Species: Mouse
• Immunogen: TRPM7 (NP_060142.2, 777 a.a. ∼ 855 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54822
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid