transient receptor potential cation channel, subfamily V, member 1, Mouse, Clone: 1F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TRPV1.

Supplier:  Abnova Corporation H00007442M01

Catalog No. 89-019-157

Description

Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a nonselective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq]

Sequence: CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ

Specifications

• Antigen: transient receptor potential cation channel, subfamily V, member 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_080706
• Gene Symbols: TRPV1
• Immunogen: TRPV1 (NP_542437, 21 a.a. ∼ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1F5
• Description: Mouse monoclonal antibody raised against a partial recombinant TRPV1.
• Gene: TRPV1
• Gene Alias: DKFZp434K0220/VR1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7442
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ