TruB pseudouridine (psi) synthase homolog 2 (E. coli), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TRUB2 protein.

Supplier:  Abnova Corporation H00026995B01

Catalog No. 89-007-413

Description

Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]).[supplied by OMIM

Sequence: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ

Specifications

• Antigen: TruB pseudouridine (psi) synthase homolog 2 (E. coli)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human TRUB2 protein.
• Gene: TRUB2
• Gene Alias: CLONE24922/RP11-339B21.1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 26995
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_015679.1
• Gene Symbols: TRUB2
• Immunogen: TRUB2 (NP_056494.1, 1 a.a. ∼ 331 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum