Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

tRNA splicing endonuclease 34 homolog (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TSEN34.

Manufacturer:  Abnova Corporation H00079042A01

Catalog No. 89-004-717


Add to cart

Description

Description

tRNA splicing is a fundamental process required for cell growth and division. SEN34 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM

Sequence: MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSA
Specifications

Specifications

tRNA splicing endonuclease 34 homolog (S. cerevisiae)
Unconjugated
50% glycerol
NM_024075
LENG5|PCH2C|SEN34|SEN34L
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
79042
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant TSEN34.
TSEN34
Serum
TSEN34
TSEN34 (NP_076980, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit