Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014252

tetraspanin 1, Mouse, Clone: 5G11, Abnova™

Catalog No. 89014252 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-252 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-252 Supplier Abnova Corporation Supplier No. H00010103M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TSPAN1.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq

Sequence: YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN

Specifications

Antigen tetraspanin 1
Applications ELISA
Classification Monoclonal
Clone 5G11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TSPAN1.
Formulation PBS with no preservative; pH 7.4
Gene TSPAN1
Gene Accession No. NM_005727
Gene Alias 9030418M05Rik/NET-1/RP11-322N21.1/TSPAN-1
Gene Symbols TSPAN1
Host Species Mouse
Immunogen TSPAN1 (NP_005718, 110 a.a. ∼ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Adhesion
Primary or Secondary Primary
Gene ID (Entrez) 10103
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.