Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001366

testis-specific serine kinase 1B, Mouse, Clone: 2E8, Abnova™

Catalog No. 89001366 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-366 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-366 Supplier Abnova Corporation Supplier No. H00083942M02
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TSSK1.

TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM

Sequence: LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ

Specifications

Antigen testis-specific serine kinase 1B
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2E8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TSSK1B.
Formulation PBS with no preservative; pH 7.4
Gene TSSK1B
Gene Accession No. BC022515
Gene Alias FKSG81/SPOGA4/STK22D/TSSK1
Gene Symbols TSSK1B
Host Species Mouse
Immunogen TSSK1B (AAH22515, 267 a.a. ∼ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 83942
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.