Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018770

testis-specific serine kinase 6, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018770 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-770 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-770 Supplier Abnova Corporation Supplier No. H00083983D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human TSSK6 protein.

TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility (Spiridonov et al., 2005 [PubMed 15870294]).[supplied by OMIM

Sequence: MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG

Specifications

Antigen testis-specific serine kinase 6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human TSSK6 protein.
Formulation PBS with no preservative; pH 7.4
Gene TSSK6
Gene Accession No. NM_032037.2
Gene Alias FLJ24002/SSTK/TSSK4
Gene Symbols TSSK6
Host Species Rabbit
Immunogen TSSK6 (NP_114426.1, 1 a.a. ∼ 273 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Primary or Secondary Primary
Gene ID (Entrez) 83983
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.