transcription termination factor, RNA polymerase II, Mouse, Clone: 3D11, Abnova™

Catalog No.	Quantity
89-001-081	100 μg

Catalog No. 89-001-081 Supplier Abnova Corporation Supplier No. H00008458M02

Description

Mouse monoclonal antibody raised against a partial recombinant TTF2.

This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing. [provided by RefSeq

Sequence: EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK

Specifications

• Antigen: transcription termination factor, RNA polymerase II
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3D11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TTF2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TTF2
• Gene Accession No.: NM_003594
• Gene Alias: HuF2
• Gene Symbols: TTF2
• Host Species: Mouse
• Immunogen: TTF2 (NP_003585, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8458
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ