Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001039

thioredoxin, Mouse, Clone: 6C10, Abnova™

Catalog No. 89001039 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-039 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-039 Supplier Abnova Corporation Supplier No. H00007295M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TXN.

Thioredoxin is a 12kDa oxidoreductase enzyme containing a dithiol-disulfide active site. It is ubiquitous and found in many organisms from plants and bacteria to mammals. Multiple in vitro substrates for thioredoxin have been identified, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin. Reduction of insulin is classically used as an activity test.[supplied by OMIM

Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Specifications

Antigen thioredoxin
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 6C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TXN.
Formulation PBS with no preservative; pH 7.4
Gene TXN
Gene Accession No. BC003377
Gene Alias DKFZp686B1993/MGC61975/TRX/TRX1
Gene Symbols TXN
Host Species Mouse
Immunogen TXN (AAH03377, 1 a.a. ∼ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7295
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.