Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014282

thioredoxin domain containing 4 (endoplasmic reticulum), Mouse, Clone: 3C7, Abnova™

Catalog No. 89014282 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-282 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-282 Supplier Abnova Corporation Supplier No. H00023071M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant TXNDC4.

Sequence: EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Specifications

Antigen thioredoxin domain containing 4 (endoplasmic reticulum)
Applications ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 3C7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant TXNDC4.
Formulation PBS with no preservative; pH 7.4
Gene TXNDC4
Gene Accession No. BC005374
Gene Alias ERP44/KIAA0573
Gene Symbols TXNDC4
Host Species Mouse
Immunogen TXNDC4 (AAH05374, 30 a.a. ∼ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23071
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.