thioredoxin domain containing 4 (endoplasmic reticulum), Mouse, Clone: 3C7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant TXNDC4.

Supplier:  Abnova Corporation H00023071M01

Catalog No. 89-014-282

Description

Sequence: EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Specifications

• Antigen: thioredoxin domain containing 4 (endoplasmic reticulum)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC005374
• Gene Symbols: TXNDC4
• Immunogen: TXNDC4 (AAH05374, 30 a.a. ∼ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 3C7
• Description: Mouse monoclonal antibody raised against a full length recombinant TXNDC4.
• Gene: TXNDC4
• Gene Alias: ERP44/KIAA0573
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23071
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ