thymidylate synthetase, Mouse, Clone: 3A1, Abnova™

Catalog No.	Quantity
89-014-208	100 μg

Catalog No. 89-014-208 Supplier Abnova Corporation Supplier No. H00007298M01

Description

Mouse monoclonal antibody raised against a partial recombinant TYMS.

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. [provided by RefSeq

Sequence: ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC

Specifications

• Antigen: thymidylate synthetase
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3A1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TYMS.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TYMS
• Gene Accession No.: BC013919
• Gene Alias: HsT422/MGC88736/TMS/TS/TSase
• Gene Symbols: TYMS
• Host Species: Mouse
• Immunogen: TYMS (AAH13919, 111 a.a. ∼ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7298
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ