TYRO3 protein tyrosine kinase, Mouse, Clone: 4F6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TYRO3.

Supplier:  Abnova Corporation H00007301M05

Catalog No. 89-014-209

Description

Sequence: VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV

Specifications

• Antigen: TYRO3 protein tyrosine kinase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC049368
• Gene Symbols: TYRO3
• Immunogen: TYRO3 (AAH49368, 50 a.a. ∼ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Adhesion
• Gene ID (Entrez): 7301
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, KnockDown, Western Blot
• Clone: 4F6
• Description: Mouse monoclonal antibody raised against a partial recombinant TYRO3.
• Gene: TYRO3
• Gene Alias: BYK/Brt/Dtk/FLJ16467/RSE/Sky/Tif
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody