ubiquitin-conjugating enzyme E2C, Mouse, Clone: 3B1, Abnova™

Catalog No.	Quantity
89-001-203	100 μg

Catalog No. 89-001-203 Supplier Abnova Corporation Supplier No. H00011065M04

Description

Mouse monoclonal antibody raised against a full-length recombinant UBE2C.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Specifications

• Antigen: ubiquitin-conjugating enzyme E2C
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3B1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant UBE2C.
• Formulation: PBS with no preservative; pH 7.4
• Gene: UBE2C
• Gene Accession No.: BC050736
• Gene Alias: UBCH10/dJ447F3.2
• Gene Symbols: UBE2C
• Host Species: Mouse
• Immunogen: UBE2C (AAH50736, 1 a.a. ∼ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11065
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ