Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human UBE2E3 protein.

Manufacturer:  Abnova Corporation H00010477B01

Catalog No. 89-006-989


Add to cart

Description

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
Specifications

Specifications

ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
Unconjugated
No additive
NM_006357
UBCH9|UbcM2
Mouse
50 uL
Ubiquitin/Proteasome
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human UBE2E3 protein.
UBE2E3
Serum
UBE2E3
UBE2E3 (NP_006348, 1 a.a. ~ 207 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10477
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit