ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human UBE2E3 protein.

Manufacturer:  Abnova Corporation H00010477B01

Catalog No. 89-006-989

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT

Specifications

• Antigen: ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_006357
• Gene Alias: UBCH9|UbcM2
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: Western Blot
• Description: Mouse polyclonal antibody raised against a full-length human UBE2E3 protein.
• Gene: UBE2E3
• Format: Serum
• Gene Symbols: UBE2E3
• Immunogen: UBE2E3 (NP_006348, 1 a.a. ~ 207 a.a) full-length human protein.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 10477