ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast), Mouse, Clone: 5E1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant UBE2G2.

Supplier:  Abnova Corporation H00007327M01

Catalog No. 89-014-210

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR

Specifications

• Antigen: ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003343
• Gene Symbols: UBE2G2
• Immunogen: UBE2G2 (NP_003329, 1 a.a. ∼ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 5E1
• Description: Mouse monoclonal antibody raised against a partial recombinant UBE2G2.
• Gene: UBE2G2
• Gene Alias: UBC7
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7327
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ