ubiquitin-conjugating enzyme E2L 6, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human UBE2L6 protein.

Supplier:  Abnova Corporation H00009246D01P

Catalog No. 89-018-652

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Specifications

• Antigen: ubiquitin-conjugating enzyme E2L 6
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human UBE2L6 protein.
• Gene: UBE2L6
• Gene Alias: MGC40331/RIG-B/UBCH8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004223.3
• Gene Symbols: UBE2L6
• Immunogen: UBE2L6 (NP_004214.1, 1 a.a. ∼ 153 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Gene ID (Entrez): 9246
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG