Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89008433

ubiquitin-conjugating enzyme E2Q family member 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89008433 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-008-433 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-008-433 Supplier Abnova Corporation Supplier No. H00092912B01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human UBE2Q2 protein.

Sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG

Specifications

Antigen ubiquitin-conjugating enzyme E2Q family member 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human UBE2Q2 protein.
Formulation No additive
Gene UBE2Q2
Gene Accession No. NM_173469.1
Gene Alias DKFZp762C143
Gene Symbols UBE2Q2
Host Species Mouse
Immunogen UBE2Q2 (NP_775740.1, 1 a.a. ∼ 375 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 92912
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.