Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014302

ubiquitin-conjugating enzyme E2T (putative), Mouse, Clone: 1E12-4A3, Abnova™

Catalog No. 89014302 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-302 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-302 Supplier Abnova Corporation Supplier No. H00029089M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant UBE2T.

The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM

Sequence: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Specifications

Antigen ubiquitin-conjugating enzyme E2T (putative)
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1E12-4A3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant UBE2T.
Formulation PBS with no preservative; pH 7.4
Gene UBE2T
Gene Accession No. BC004152
Gene Alias HSPC150/PIG50
Gene Symbols UBE2T
Host Species Mouse
Immunogen UBE2T (AAH04152, 1 a.a. ∼ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Primary or Secondary Primary
Gene ID (Entrez) 29089
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.