UBE3A, Mouse, Clone: 3E5, Abnova™

Catalog No.	Quantity
89-002-715	100 μg

Catalog No. 89-002-715 Supplier Abnova Corporation Supplier No. H00007337M02

Description

Mouse monoclonal antibody raised against a partial recombinant UBE3A.

This gene encodes an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53. Alternative splicing of this gene results in three transcript variants encoding three isoforms with different N-termini. Additional transcript variants have been described, but their full length nature has not been determined. [provided by RefSeq

Sequence: ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCR

Specifications

• Antigen: UBE3A,
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant UBE3A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: UBE3A
• Gene Accession No.: BC009271
• Gene Alias: ANCR/AS/E6-AP/EPVE6AP/FLJ26981/HPVE6A
• Gene Symbols: UBE3A
• Host Species: Mouse
• Immunogen: UBE3A (AAH09271, 51 a.a. ∼ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7337
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ