Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001500

ubiquitin-like 4A, Mouse, Clone: 1C10, Abnova™

Catalog No. 89001500 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-500 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-500 Supplier Abnova Corporation Supplier No. H00008266M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant UBL4A.

Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

Specifications

Antigen ubiquitin-like 4A
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant UBL4A.
Formulation ascites with no preservative
Gene UBL4A
Gene Accession No. BC043346
Gene Alias DX254E/DXS254E/G6PD/GDX/UBL4
Gene Symbols UBL4A
Host Species Mouse
Immunogen UBL4A (AAH43346, 1 a.a. ∼ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 8266
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.