ubiquilin 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-607	50 μL

Catalog No. 89-004-607 Supplier Abnova Corporation Supplier No. H00029978A01

Description

Mouse polyclonal antibody raised against a partial recombinant UBQLN2.

This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. [provided by RefSeq

Sequence: PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS

Specifications

• Antigen: ubiquilin 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UBQLN2.
• Formulation: 50% glycerol
• Gene: UBQLN2
• Gene Accession No.: NM_013444
• Gene Alias: CHAP1/CHAP1/DSK2/Dsk2/HRIHFB2157/LIC-2/N4BP4/PLIC-2/PLIC2/RIHFB2157
• Gene Symbols: UBQLN2
• Host Species: Mouse
• Immunogen: UBQLN2 (NP_038472, 555 a.a. ∼ 624 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 29978
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum