ubiquitin protein ligase E3 component n-recognin 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-813	50 μL

Catalog No. 89-004-813 Supplier Abnova Corporation Supplier No. H00197131A01

Description

Mouse polyclonal antibody raised against a partial recombinant UBR1.

The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq

Sequence: ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG

Specifications

• Antigen: ubiquitin protein ligase E3 component n-recognin 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UBR1.
• Formulation: 50% glycerol
• Gene: UBR1
• Gene Accession No.: NM_17491
• Gene Alias: JBS/MGC142065/MGC142067
• Gene Symbols: UBR1
• Host Species: Mouse
• Immunogen: UBR1 (NP_777576, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 197131
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum