ubiquitin protein ligase E3 component n-recognin 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant UBR1.

Manufacturer:  Abnova Corporation H00197131A01

Catalog No. 89-004-813

Description

The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq

Sequence: ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG

Specifications

• Antigen: ubiquitin protein ligase E3 component n-recognin 1
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_17491
• Gene Alias: JBS|MGC142065|MGC142067
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant UBR1.
• Gene: UBR1
• Format: Serum
• Gene Symbols: UBR1
• Immunogen: UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 197131