upstream binding transcription factor, RNA polymerase I, Mouse, Clone: 6C6, Abnova™

Catalog No.	Quantity
89-001-042	100 μg

Catalog No. 89-001-042 Supplier Abnova Corporation Supplier No. H00007343M02

Description

Mouse monoclonal antibody raised against a partial recombinant UBTF.

Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97kDa, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM

Sequence: PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS

Specifications

• Antigen: upstream binding transcription factor, RNA polymerase I
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6C6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant UBTF.
• Formulation: PBS with no preservative; pH 7.4
• Gene: UBTF
• Gene Accession No.: NM_014233
• Gene Alias: NOR-90/UBF
• Gene Symbols: UBTF
• Host Species: Mouse
• Immunogen: UBTF (NP_055048, 551 a.a. ∼ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7343
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ