Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89002627

UCRC, Mouse, Clone: 2B5, Abnova™

Catalog No. 89002627 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-627 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-627 Supplier Abnova Corporation Supplier No. H00029796M07
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant UCRC.

UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM

Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Specifications

Antigen UCRC
Applications ELISA
Classification Monoclonal
Clone 2B5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant UCRC.
Formulation PBS with no preservative; pH 7.4
Gene UCRC
Gene Accession No. BC005402
Gene Alias HSPC051/HSPC119/HSPC151
Gene Symbols UCRC
Host Species Mouse
Immunogen UCRC (AAH05402, 1 a.a. ∼ 63 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29796
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.