UDP-glucose ceramide glucosyltransferase, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant UGCG.

Supplier:  Abnova Corporation H00007357A01

Catalog No. 89-018-851

Description

Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation. [provided by RefSeq

Sequence: TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG

Specifications

• Antigen: UDP-glucose ceramide glucosyltransferase
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant UGCG.
• Gene: UGCG
• Gene Alias: GCS
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003358
• Gene Symbols: UGCG
• Immunogen: UGCG (NP_003349, 33 a.a. ∼ 131 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 7357
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.