Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    UGP2 Antibody, Novus Biologicals™
 
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP185918
Description
UGP2 Polyclonal specifically detects UGP2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| UGP2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| EC 2.7.7.9, pHC379, UDPG, UDP-glucose diphosphorylase, UDP-glucose pyrophosphorylase, UDP-glucose pyrophosphorylase 2, UDPGP, UDPGP2, UGP1, UGPase, UGPase 2, UGPP2, uridyl diphosphate glucose pyrophosphorylase 2, UTP-glucose-1-phosphate uridyltransferase, UTP--glucose-1-phosphate uridylyltransferase, UTP--glucose-1-phosphate uridylyltransferase 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human UGP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | 
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| UGP2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL | |
| 0.1 mL | |
| Stem Cell Markers | |
| 7360 | |
| Human, Mouse, Rat | |
| IgG | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
             
                             
                            