ubiquitin-like with PHD and ring finger domains 1, Mouse, Clone: 3B12, Abnova™

Catalog No.	Quantity
89-001-260	100 μg

Catalog No. 89-001-260 Supplier Abnova Corporation Supplier No. H00029128M02

Description

Mouse monoclonal antibody raised against a partial recombinant UHRF1.

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR

Specifications

• Antigen: ubiquitin-like with PHD and ring finger domains 1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3B12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant UHRF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: UHRF1
• Gene Accession No.: NM_013282
• Gene Alias: FLJ21925/ICBP90/MGC138707/Np95/RNF106/hNP95
• Gene Symbols: UHRF1
• Host Species: Mouse
• Immunogen: UHRF1 (NP_037414, 694 a.a. ∼ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 29128
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ