unc-51-like kinase 2 (C. elegans), Mouse, Clone: 5E4, Abnova™

Catalog No.	Quantity
89-001-148	100 μg

Catalog No. 89-001-148 Supplier Abnova Corporation Supplier No. H00009706M10

Description

Mouse monoclonal antibody raised against a partial recombinant ULK2.

This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a central proline/serine rich (PS) domain, and a C-terminal (C) domain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECVLDL

Specifications

• Antigen: unc-51-like kinase 2 (C. elegans)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5E4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ULK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ULK2
• Gene Accession No.: BC034988
• Gene Alias: KIAA0623/Unc51.2
• Gene Symbols: ULK2
• Host Species: Mouse
• Immunogen: ULK2 (AAH34988, 743 a.a. ∼ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9706
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ