unc-13 homolog D (C. elegans), Mouse, Clone: 1E11, Abnova™

Catalog No.	Quantity
89-001-405	100 μg

Catalog No. 89-001-405 Supplier Abnova Corporation Supplier No. H00201294M06

Description

Mouse monoclonal antibody raised against a partial recombinant UNC13D.

This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder. [provided by RefSeq

Sequence: ATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDALYTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTL

Specifications

• Antigen: unc-13 homolog D (C. elegans)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant UNC13D.
• Formulation: PBS with no preservative; pH 7.4
• Gene: UNC13D
• Gene Accession No.: NM_199242
• Gene Alias: FHL3/HLH3/HPLH3/Munc13-4
• Gene Symbols: UNC13D
• Host Species: Mouse
• Immunogen: UNC13D (NP_954712.1, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 201294
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ