Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VAMP (vesicle-associated membrane protein)-associated protein B and C, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human VAPB protein.

Manufacturer:  Abnova Corporation H00009217D01P

Catalog No. 89-018-648


  Check Availability
Add to cart

Specifications

Description

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq

Sequence: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Description & Specifications

Specifications

VAMP (vesicle-associated membrane protein)-associated protein B and C
Unlabeled
VAMP (vesicle-associated membrane protein)-associated protein B and C
In 1X PBS, pH 7.4
NM_004738.3
VAPB
VAPB (NP_004729.1, 1 a.a. ∽243 a.a) full-length human protein.
100μg
Human, Mouse
Primary
9217
Western Blot
Human,Mouse
Affinity Purified
VAPB
ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C
Rabbit
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human,Murine
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit