VAMP (vesicle-associated membrane protein)-associated protein B and C, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human VAPB protein.

Manufacturer: Abnova Corporation H00009217D01P

Catalog No. 89-018-648

  Check Availability
Add to Cart

    Specifications

    Antigen VAMP (vesicle-associated membrane protein)-associated protein B and C
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human,Mouse
    Description VAMP (vesicle-associated membrane protein)-associated protein B and C
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene VAPB
    Gene Accession No. NM_004738.3
    Gene Alias ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C
    Gene Symbols VAPB
    Host Species Rabbit
    Immunogen VAPB (NP_004729.1, 1 a.a. ∽243 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Species Reactivity Human, Mouse
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 9217

    The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq

    Sequence: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit