valyl-tRNA synthetase, Mouse, Clone: 4B7, Abnova™

Catalog No.	Quantity
89-014-211	100 μg

Catalog No. 89-014-211 Supplier Abnova Corporation Supplier No. H00007407M01

Description

Mouse monoclonal antibody raised against a partial recombinant VARS.

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. The protein encoded by this gene belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex. [provided by RefSeq

Sequence: AVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPEPSECSWKDP

Specifications

• Antigen: valyl-tRNA synthetase
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant VARS.
• Formulation: PBS with no preservative; pH 7.4
• Gene: VARS
• Gene Accession No.: NM_006295
• Gene Alias: G7A/VARS1/VARS2
• Gene Symbols: VARS
• Host Species: Mouse
• Immunogen: VARS (NP_006286, 994 a.a. ∼ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7407
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ